Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR11H12 Rabbit Polyclonal Antibody (HRP)

OR11H12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

B2RN74

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human OR11H12

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CPLTLQVTGLMNVSEPNSSFAFVNEFILQGFTCEWTIQIFLFSLFTTTYA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001013372

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein A TRITC Colloidal Gold, 1mL 30nm
RGP-01-30 1 mL

Protein A TRITC Colloidal Gold, 1mL 30nm

Sign In for Pricing
View Details
FNDC8 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C12]
TA507222AM 100 µL

FNDC8 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C12]

Sign In for Pricing
View Details
MTMR4 (C-term) Rabbit Polyclonal Antibody
AP13507PU-N 400 µL

MTMR4 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PKN1 (NM_002741) Human Over-expression Lysate
LY419135 100 µg

PKN1 (NM_002741) Human Over-expression Lysate

Sign In for Pricing
View Details
Bulk Human IgG1 (IB1) Isotype Control LALA
ICH2254LALA-5mg 5 mg

Bulk Human IgG1 (IB1) Isotype Control LALA

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Robinia pseudoacacia (Black Locust) -RPA-
LA-4101-1 1 mg

Alkaline Phosphatase Conjugated Robinia pseudoacacia (Black Locust) -RPA-

Sign In for Pricing
View Details