Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AADACL4 Rabbit Polyclonal Antibody (HRP)

AADACL4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q5VUY2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human AADACL4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FIRFLHDSVRIKKDPELVVTDLRFGTIPVRLFQPKAASSRPRRGIIFYHG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001013652

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NLRP6 Antibody, Biotin conjugated
CSB-PA015874LD01HU-01 50 µg

NLRP6 Antibody, Biotin conjugated

Sign In for Pricing
View Details
NLRP6 Antibody, Biotin conjugated
CSB-PA015874LD01HU-02 100 µg

NLRP6 Antibody, Biotin conjugated

Sign In for Pricing
View Details
SKP2 Rabbit Polyclonal Antibody (APC)
orb2579872 100 µg

SKP2 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Non-printed, non-assembled Screw Cap Tube, Self-Standing, PP, 2.0 mL, with EPDM ring Cap, Blue - 1000 un , DNase/RNase free - ABDOS
P10237B 1000 Units/Pack

Non-printed, non-assembled Screw Cap Tube, Self-Standing, PP, 2.0 mL, with EPDM ring Cap, Blue - 1000 un , DNase/RNase free - ABDOS

Sign In for Pricing
View Details
IL-1b/IL-1F2 (Interleukin 1b) Monkey ELISA Kit
E2067 96 Tests

IL-1b/IL-1F2 (Interleukin 1b) Monkey ELISA Kit

Sign In for Pricing
View Details
Anti-BCHE Antibody (9C796)
TMAB-03042-01 25 µL

Anti-BCHE Antibody (9C796)

Sign In for Pricing
View Details