Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AADACL4 Rabbit Polyclonal Antibody (HRP)

AADACL4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q5VUY2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AADACL4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IRAQVLIYPVVQAFCLQLPSFQQNQNVPLLSRKFMVTSLCNYLAIDLSWR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001013652

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human A Disintegrin and Metalloproteinase Domain 10
7-04270 2 µg

Recombinant Human A Disintegrin and Metalloproteinase Domain 10

Sign In for Pricing
View Details
Lentiviral human NFKBIE shRNA (UAS) - Lentiviral human NFKBIE shRNA (UAS, iRFP) (100)
GTR15308922 1 Vial

Lentiviral human NFKBIE shRNA (UAS) - Lentiviral human NFKBIE shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Rabbit anti-CEL5Rl Antibody, Affinity Purified
A304-433A-T 10 µg

Rabbit anti-CEL5Rl Antibody, Affinity Purified

Sign In for Pricing
View Details
Goat Opacity-associated proteins (OPAs) ELISA Kit
NSL0342Gt 96 Tests

Goat Opacity-associated proteins (OPAs) ELISA Kit

Sign In for Pricing
View Details
Canine Collagen Type IV (COL4) ELISA Kit
MBS2606457-01 48 Well

Canine Collagen Type IV (COL4) ELISA Kit

Sign In for Pricing
View Details
Canine Collagen Type IV (COL4) ELISA Kit
MBS2606457-02 96 Well

Canine Collagen Type IV (COL4) ELISA Kit

Sign In for Pricing
View Details