Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AADACL4 Rabbit Polyclonal Antibody (HRP)

AADACL4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q5VUY2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AADACL4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IRAQVLIYPVVQAFCLQLPSFQQNQNVPLLSRKFMVTSLCNYLAIDLSWR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001013652

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SATL1, CT (SATL1, Spermidine/spermine N (1) -acetyltransferase-like protein 1) (MaxLight 750) discontinued
041433-ML750 100 µL

SATL1, CT (SATL1, Spermidine/spermine N (1) -acetyltransferase-like protein 1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
POLE4 Protein Lysate (Human) with C-Ha Tag
37156031 100 µg

POLE4 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
PDAP1 (NM_014891) Human Tagged ORF Clone
RC200058 10 µg

PDAP1 (NM_014891) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Zinc finger protein 276, Znf276 ELISA KIT
ELI-14782m 96 Tests

Mouse Zinc finger protein 276, Znf276 ELISA KIT

Sign In for Pricing
View Details
Lrrc46 Rat shRNA Plasmid (Locus ID 287653)
TL700541 1 Kit

Lrrc46 Rat shRNA Plasmid (Locus ID 287653)

Sign In for Pricing
View Details
Human KLRG1 Protein, hFc Tag
MBS188347 Inquire

Human KLRG1 Protein, hFc Tag

Sign In for Pricing
View Details