Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CUTA Rabbit Polyclonal Antibody (Biotin)

CUTA Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ACHAP, C6orf82

UniProt

O60888

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CUTA

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001014840

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPMT1 (Protein Tyrosine Phosphatase, Mitochondrial 1, DUSP23, FLJ46081, MOSP, PLIP, PNAS-129)
250686 50 µL

PTPMT1 (Protein Tyrosine Phosphatase, Mitochondrial 1, DUSP23, FLJ46081, MOSP, PLIP, PNAS-129)

Sign In for Pricing
View Details
SRA1, CT (SRA1, Steroid receptor RNA activator 1, Steroid receptor RNA activator protein) (Biotin) discontinued
042286-Biotin 200 µL

SRA1, CT (SRA1, Steroid receptor RNA activator 1, Steroid receptor RNA activator protein) (Biotin) discontinued

Sign In for Pricing
View Details
Research Grade amdokitug
HS856256-01 100 µg

Research Grade amdokitug

Sign In for Pricing
View Details
Research Grade amdokitug
HS856256-02 1 mg

Research Grade amdokitug

Sign In for Pricing
View Details
Recombinant Salmonella typhi Universal stress protein C (uspC)
MBS1469557-01 0.02 mg (E-Coli)

Recombinant Salmonella typhi Universal stress protein C (uspC)

Sign In for Pricing
View Details
Recombinant Salmonella typhi Universal stress protein C (uspC)
MBS1469557-02 0.1 mg (E-Coli)

Recombinant Salmonella typhi Universal stress protein C (uspC)

Sign In for Pricing
View Details