Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM9SF1 Rabbit Polyclonal Antibody (HRP)

TM9SF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MP70, HMP70

UniProt

O15321

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TM9SF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLG

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_006396

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALKBH5 (NM_017758) Human Recombinant Protein
E45H30255E1 50 µg

ALKBH5 (NM_017758) Human Recombinant Protein

Sign In for Pricing
View Details
KLHL12 Peptide - N-terminal region
MBS3227153-01 0.1 mg

KLHL12 Peptide - N-terminal region

Sign In for Pricing
View Details
KLHL12 Peptide - N-terminal region
MBS3227153-02 5x 0.1 mg

KLHL12 Peptide - N-terminal region

Sign In for Pricing
View Details
PUM3 Rabbit Polyclonal Antibody (HRP)
orb2117066 100 µL

PUM3 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Haemophilus somnus Thymidylate kinase (tmk)
MBS1025228-01 0.02 mg (E-Coli)

Recombinant Haemophilus somnus Thymidylate kinase (tmk)

Sign In for Pricing
View Details
Recombinant Haemophilus somnus Thymidylate kinase (tmk)
MBS1025228-02 0.1 mg (E-Coli)

Recombinant Haemophilus somnus Thymidylate kinase (tmk)

Sign In for Pricing
View Details