Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM9SF1 Rabbit Polyclonal Antibody (HRP)

TM9SF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MP70, HMP70

UniProt

O15321

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TM9SF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLG

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_006396

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Complement C1q tumor necrosis factor-related protein 2 (C1QTNF2) ELISA Kit
abx504267 96 Tests

Mouse Complement C1q tumor necrosis factor-related protein 2 (C1QTNF2) ELISA Kit

Sign In for Pricing
View Details
CPA3 Rabbit Polyclonal Antibody
TA420531 100 µg

CPA3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-IGF1 Receptor Rabbit Monoclonal Antibody
MA3197-.1 100 µL

Anti-IGF1 Receptor Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ZNF195 (NM_007152) Human 3' UTR Clone
SC204475 10 µg

ZNF195 (NM_007152) Human 3' UTR Clone

Sign In for Pricing
View Details
WISP2 Rabbit Polyclonal Antibody (AP)
orb896532 100 µL

WISP2 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Mouse Monoclonal Integrin alpha 3/CD49c Antibody (29A3) [DyLight 488]
NBP1-97692G 0.1 mL

Mouse Monoclonal Integrin alpha 3/CD49c Antibody (29A3) [DyLight 488]

Sign In for Pricing
View Details