Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM9SF1 Rabbit Polyclonal Antibody (FITC)

TM9SF1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MP70, HMP70

UniProt

O15321

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TM9SF1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLR

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006396

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Catenin Beta 1 (CTNNb1) ELISA Kit
RDR-CTNNb1-Ra-01 96 Tests

Rat Catenin Beta 1 (CTNNb1) ELISA Kit

Sign In for Pricing
View Details
Rat Catenin Beta 1 (CTNNb1) ELISA Kit
RDR-CTNNb1-Ra-02 48 Tests

Rat Catenin Beta 1 (CTNNb1) ELISA Kit

Sign In for Pricing
View Details
Ppp1r1b (NM_144828) Mouse Tagged ORF Clone
MG201884 10 µg

Ppp1r1b (NM_144828) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Dysferlin interacting protein 1 (PPP1R27) (NM_001007533) Human Recombinant Protein
TP310807M 100 µg

Dysferlin interacting protein 1 (PPP1R27) (NM_001007533) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Joint
CS707185 5x 5 µm

Tissue FFPE Sections, Joint

Sign In for Pricing
View Details
HSP27 (HSPB1/774), CF647 conjugate, 0.1mg/mL
BNC470774-100 1x 100 µL

HSP27 (HSPB1/774), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details