Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM9SF1 Rabbit Polyclonal Antibody (HRP)

TM9SF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MP70, HMP70

UniProt

O15321

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TM9SF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLR

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006396

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm572 (NM_001085505) Mouse Tagged ORF Clone Lentiviral Particle
MR212543L4V 200 µL

Gm572 (NM_001085505) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Polyclonal RANBP9 Antibody
NBP3-21406-25ul 25 µL

Rabbit Polyclonal RANBP9 Antibody

Sign In for Pricing
View Details
Human CellExp™ UNC5B, human recombinant
7576-10 10 µg

Human CellExp™ UNC5B, human recombinant

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii ATP synthase subunit b (atpF), partial
MBS7053754 Inquire

Recombinant Acinetobacter baumannii ATP synthase subunit b (atpF), partial

Sign In for Pricing
View Details
Human Leucine-rich alpha-2-glycoprotein (LRG1) ELISA Kit
abx576100 96 Well

Human Leucine-rich alpha-2-glycoprotein (LRG1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal PPPDE1 Antibody
NBP2-85517-0.1mL 0.1 mL

Rabbit Polyclonal PPPDE1 Antibody

Sign In for Pricing
View Details