Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLTPD2 Rabbit Polyclonal Antibody (HRP)

GLTPD2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

A6NH11

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LOC388323

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GARSGCGPRAQPCVPGETAPFQVRQESGTLEAPERKQPPCLGPRGMLGRM

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001014985

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Raf-B (Serine/Threonine-Protein Kinase B-raf, Proto-Oncogene B-Raf, p94, v-Raf murine Sarcoma Viral Oncogene Homolog B1, BRAF, BRAF1, RAFB1) discontinued
225443-01 50 µL

Raf-B (Serine/Threonine-Protein Kinase B-raf, Proto-Oncogene B-Raf, p94, v-Raf murine Sarcoma Viral Oncogene Homolog B1, BRAF, BRAF1, RAFB1) discontinued

Sign In for Pricing
View Details
Raf-B (Serine/Threonine-Protein Kinase B-raf, Proto-Oncogene B-Raf, p94, v-Raf murine Sarcoma Viral Oncogene Homolog B1, BRAF, BRAF1, RAFB1) discontinued
225443-02 100 µL

Raf-B (Serine/Threonine-Protein Kinase B-raf, Proto-Oncogene B-Raf, p94, v-Raf murine Sarcoma Viral Oncogene Homolog B1, BRAF, BRAF1, RAFB1) discontinued

Sign In for Pricing
View Details
C17orf79 Protein Vector (Human) (pPB-C-His)
PV065905 500 ng

C17orf79 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
5,8,11-eicosatriynoic acid
MBS394072-01 5 mg

5,8,11-eicosatriynoic acid

Sign In for Pricing
View Details
5,8,11-eicosatriynoic acid
MBS394072-02 5x 5 mg

5,8,11-eicosatriynoic acid

Sign In for Pricing
View Details
Recombinant Mouse Secretory carrier-associated membrane protein 4 (Scamp4), partial
MBS7098700 Inquire

Recombinant Mouse Secretory carrier-associated membrane protein 4 (Scamp4), partial

Sign In for Pricing
View Details