Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLTPD2 Rabbit Polyclonal Antibody (Biotin)

GLTPD2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

A6NH11

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LOC388323

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LAAMAAWERRAGLLEQPGAAPRDPTRSSGSRTLLLLHRALRWSQLCLHRV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001014985

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 alpha, beta (CD8 alpha, CD8a, CD8 alpha Chain, CD8 Antigen alpha Chain, CD8 Antigen alpha Polypeptide (p32), CD8 beta, CD8b, CD8 Antigen beta Polypeptide 1, CD8B1, Leu2 T Lymphocyte Antigen, Leu-2, Leu2, Ly3, LYT3, MAL, MGC119115, OKT8 T cell Antigen,
MBS6251664-01 0.1 mL

CD8 alpha, beta (CD8 alpha, CD8a, CD8 alpha Chain, CD8 Antigen alpha Chain, CD8 Antigen alpha Polypeptide (p32), CD8 beta, CD8b, CD8 Antigen beta Polypeptide 1, CD8B1, Leu2 T Lymphocyte Antigen, Leu-2, Leu2, Ly3, LYT3, MAL, MGC119115, OKT8 T cell Antigen,

Sign In for Pricing
View Details
CD8 alpha, beta (CD8 alpha, CD8a, CD8 alpha Chain, CD8 Antigen alpha Chain, CD8 Antigen alpha Polypeptide (p32), CD8 beta, CD8b, CD8 Antigen beta Polypeptide 1, CD8B1, Leu2 T Lymphocyte Antigen, Leu-2, Leu2, Ly3, LYT3, MAL, MGC119115, OKT8 T cell Antigen,
MBS6251664-02 5x 0.1 mL

CD8 alpha, beta (CD8 alpha, CD8a, CD8 alpha Chain, CD8 Antigen alpha Chain, CD8 Antigen alpha Polypeptide (p32), CD8 beta, CD8b, CD8 Antigen beta Polypeptide 1, CD8B1, Leu2 T Lymphocyte Antigen, Leu-2, Leu2, Ly3, LYT3, MAL, MGC119115, OKT8 T cell Antigen,

Sign In for Pricing
View Details
Annexin A13 (ANXA13, ISA, ANX13, Annexin XIII, Annexin-13, Intestine-specific Annexin) (MaxLight 550)
137537-ML550 100 µL

Annexin A13 (ANXA13, ISA, ANX13, Annexin XIII, Annexin-13, Intestine-specific Annexin) (MaxLight 550)

Sign In for Pricing
View Details
COLQ CytoSection
TS410401P5 25 Slides

COLQ CytoSection

Sign In for Pricing
View Details
Rabbit Polyclonal ALS2CR2 Antibody [Alexa Fluor 488]
NB100-442AF488 0.1 mL

Rabbit Polyclonal ALS2CR2 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
SLC1A4 Protein Vector (Rat) (pPM-C-HA)
43925026 500 ng

SLC1A4 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details