Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPG Rabbit Polyclonal Antibody (Biotin)

MPG Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AAG, MDG, ADPG, APNG, Mid1, anpg, PIG11, PIG16, CRA36.1

UniProt

P29372

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MPG

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QRDLAQDEAVWLERGPLEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGS

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_001015054

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JanB Antibody
orb806004 2 mg

JanB Antibody

Sign In for Pricing
View Details
VPS51 Antibody, HRP conjugated
CSB-PA883424LB01HU-01 50 μL

VPS51 Antibody, HRP conjugated

Sign In for Pricing
View Details
VPS51 Antibody, HRP conjugated
CSB-PA883424LB01HU-02 100 µL

VPS51 Antibody, HRP conjugated

Sign In for Pricing
View Details
OLR1 (Oxidized Low Density Lipoprotein Receptor 1, LOX1, LOXIN, SLOX1, CLEC8A, SCARE1) (MaxLight 750)
MBS6430157-01 0.1 mL

OLR1 (Oxidized Low Density Lipoprotein Receptor 1, LOX1, LOXIN, SLOX1, CLEC8A, SCARE1) (MaxLight 750)

Sign In for Pricing
View Details
OLR1 (Oxidized Low Density Lipoprotein Receptor 1, LOX1, LOXIN, SLOX1, CLEC8A, SCARE1) (MaxLight 750)
MBS6430157-02 5x 0.1 mL

OLR1 (Oxidized Low Density Lipoprotein Receptor 1, LOX1, LOXIN, SLOX1, CLEC8A, SCARE1) (MaxLight 750)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis Putative ATP:guanido phosphotransferase SERP0164 (SERP0164)
MBS1371480-01 0.02 mg (E-Coli)

Recombinant Staphylococcus epidermidis Putative ATP:guanido phosphotransferase SERP0164 (SERP0164)

Sign In for Pricing
View Details