Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPG Rabbit Polyclonal Antibody (FITC)

MPG Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AAG, MDG, ADPG, APNG, Mid1, anpg, PIG11, PIG16, CRA36.1

UniProt

Q5J9I4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MPG

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001015052

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FCGR2C peptide
orb218216-01 1 mg

FCGR2C peptide

Sign In for Pricing
View Details
FCGR2C peptide
orb218216-02 5 mg

FCGR2C peptide

Sign In for Pricing
View Details
Histone H3 (acetyl K23) Rabbit monoclonal antibody
orb2297089-01 25 µL

Histone H3 (acetyl K23) Rabbit monoclonal antibody

Sign In for Pricing
View Details
Histone H3 (acetyl K23) Rabbit monoclonal antibody
orb2297089-02 50 µL

Histone H3 (acetyl K23) Rabbit monoclonal antibody

Sign In for Pricing
View Details
Histone H3 (acetyl K23) Rabbit monoclonal antibody
orb2297089-03 100 µL

Histone H3 (acetyl K23) Rabbit monoclonal antibody

Sign In for Pricing
View Details
Recombinant Bacillus cereus Small, acid-soluble spore protein I (sspI)
MBS1438668-01 0.02 mg (E-Coli)

Recombinant Bacillus cereus Small, acid-soluble spore protein I (sspI)

Sign In for Pricing
View Details