Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnajc25 Rabbit Polyclonal Antibody (Biotin)

Dnajc25 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

2010109C08Rik, 2010203O07Rik

UniProt

A2ALW5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SYLATVPKYRIQATEIAKEQGLLKKAKEKGKNKKSKEEIRDEEENIIKNI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001028337

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-12 p40, Human
MBS8575317-01 0.005 mg

IL-12 p40, Human

Sign In for Pricing
View Details
IL-12 p40, Human
MBS8575317-02 5x 0.005 mg

IL-12 p40, Human

Sign In for Pricing
View Details
GTF2H2C, CT (GTF2H2C, General transcription factor IIH subunit 2-like protein, General transcription factor IIH polypeptide 2-like protein) (MaxLight 490)
MBS6304894-01 0.1 mL

GTF2H2C, CT (GTF2H2C, General transcription factor IIH subunit 2-like protein, General transcription factor IIH polypeptide 2-like protein) (MaxLight 490)

Sign In for Pricing
View Details
GTF2H2C, CT (GTF2H2C, General transcription factor IIH subunit 2-like protein, General transcription factor IIH polypeptide 2-like protein) (MaxLight 490)
MBS6304894-02 5x 0.1 mL

GTF2H2C, CT (GTF2H2C, General transcription factor IIH subunit 2-like protein, General transcription factor IIH polypeptide 2-like protein) (MaxLight 490)

Sign In for Pricing
View Details
Mouse CD33 Protein, hFc Tag
MBS189222-01 0.01 mg

Mouse CD33 Protein, hFc Tag

Sign In for Pricing
View Details
Mouse CD33 Protein, hFc Tag
MBS189222-02 0.05 mg

Mouse CD33 Protein, hFc Tag

Sign In for Pricing
View Details