Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnajc25 Rabbit Polyclonal Antibody (HRP)

Dnajc25 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

2010109C08Rik, 2010203O07Rik

UniProt

A2ALW5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SYLATVPKYRIQATEIAKEQGLLKKAKEKGKNKKSKEEIRDEEENIIKNI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001028337

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ultra Nuclease GMP-grade, 1 pack = 50 KU
BAL6595 1 Pack

Ultra Nuclease GMP-grade, 1 pack = 50 KU

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to 2',5'-Oligoadenylate Synthetase 1 (OAS1)
MBS2146515-01 0.1 mL

Cy3-Linked Polyclonal Antibody to 2',5'-Oligoadenylate Synthetase 1 (OAS1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to 2',5'-Oligoadenylate Synthetase 1 (OAS1)
MBS2146515-02 0.2 mL

Cy3-Linked Polyclonal Antibody to 2',5'-Oligoadenylate Synthetase 1 (OAS1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to 2',5'-Oligoadenylate Synthetase 1 (OAS1)
MBS2146515-03 0.5 mL

Cy3-Linked Polyclonal Antibody to 2',5'-Oligoadenylate Synthetase 1 (OAS1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to 2',5'-Oligoadenylate Synthetase 1 (OAS1)
MBS2146515-04 1 mL

Cy3-Linked Polyclonal Antibody to 2',5'-Oligoadenylate Synthetase 1 (OAS1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to 2',5'-Oligoadenylate Synthetase 1 (OAS1)
MBS2146515-05 5 mL

Cy3-Linked Polyclonal Antibody to 2',5'-Oligoadenylate Synthetase 1 (OAS1)

Sign In for Pricing
View Details