Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC25 Rabbit Polyclonal Antibody (Biotin)

DNAJC25 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BA16L21.2.1

UniProt

Q9H1X3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DNAJC25

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RDEEENIIKNIIKSKIDIKGGYQKPQICDLLLFQIILAPFHLCSYIVWYC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001015882

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 Rabbit Polyclonal Antibody (BF350)
orb1581095 100 µL

CD46 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
TIMM8B (Mitochondrial Import Inner Membrane Translocase Subunit Tim8 B, TIM8B, DDP-like Protein, DDPL, Deafness Dystonia Protein 2, DDP2) (MaxLight 750) discontinued
134452-ML750 100 µL

TIMM8B (Mitochondrial Import Inner Membrane Translocase Subunit Tim8 B, TIM8B, DDP-like Protein, DDPL, Deafness Dystonia Protein 2, DDP2) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Human CST complex subunit CTC1 (C17orf68) ELISA Kit
MBS7231682-01 48 Well

Human CST complex subunit CTC1 (C17orf68) ELISA Kit

Sign In for Pricing
View Details
Human CST complex subunit CTC1 (C17orf68) ELISA Kit
MBS7231682-02 96 Well

Human CST complex subunit CTC1 (C17orf68) ELISA Kit

Sign In for Pricing
View Details
Human CST complex subunit CTC1 (C17orf68) ELISA Kit
MBS7231682-03 5x 96 Well

Human CST complex subunit CTC1 (C17orf68) ELISA Kit

Sign In for Pricing
View Details
Human CST complex subunit CTC1 (C17orf68) ELISA Kit
MBS7231682-04 10x 96 Well

Human CST complex subunit CTC1 (C17orf68) ELISA Kit

Sign In for Pricing
View Details