Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGSF11 Rabbit Polyclonal Antibody (HRP)

IGSF11 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CT119, VSIG3, Igsf13, BT-IgSF, CXADRL1

UniProt

Q5DX21

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IGSF11

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001015887

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHM Recombinant Rabbit Monoclonal Antibody [JE61-83]
HA720064 100 µL

CHM Recombinant Rabbit Monoclonal Antibody [JE61-83]

Sign In for Pricing
View Details
Snrnp48 Mouse Gene Knockout Kit (CRISPR)
KN516398 1 Kit

Snrnp48 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ATG4D activation kit by CRISPRa
GA113811 1 Kit

Human ATG4D activation kit by CRISPRa

Sign In for Pricing
View Details
Human BOD1L2 activation kit by CRISPRa
GA117110 1 Kit

Human BOD1L2 activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (NM_002273) Human Over-expression Lysate
LC419425 20 µg

Cytokeratin 8 (KRT8) (NM_002273) Human Over-expression Lysate

Sign In for Pricing
View Details
Pure Agaricus bisporus Lectin (Mushroom) -ABA-
L-5001-2 2 mg

Pure Agaricus bisporus Lectin (Mushroom) -ABA-

Sign In for Pricing
View Details