Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM30B Rabbit Polyclonal Antibody (Biotin)

TMEM30B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CDC50B

UniProt

Q3MIR4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TMEM30B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VYLYYELTNFYQNNRRYGVSRDDAQLSGLPSALRHPVNECAPYQRSAAGL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001017970

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COBL, NT (COBL, KIAA0633, Protein cordon-bleu) (MaxLight 750)
MBS6287458-01 0.1 mL

COBL, NT (COBL, KIAA0633, Protein cordon-bleu) (MaxLight 750)

Sign In for Pricing
View Details
COBL, NT (COBL, KIAA0633, Protein cordon-bleu) (MaxLight 750)
MBS6287458-02 5x 0.1 mL

COBL, NT (COBL, KIAA0633, Protein cordon-bleu) (MaxLight 750)

Sign In for Pricing
View Details
Lentiviral human MAPK14 shRNA (UAS) - Lentiviral human MAPK14 shRNA (UAS) (100)
GTR15326709 1 Vial

Lentiviral human MAPK14 shRNA (UAS) - Lentiviral human MAPK14 shRNA (UAS) (100)

Sign In for Pricing
View Details
Lentiviral mouse Abcd1 shRNA (UAS) - Lentiviral mouse Abcd1 shRNA (UAS, iRFP) (25)
GTR15216254 1 Vial

Lentiviral mouse Abcd1 shRNA (UAS) - Lentiviral mouse Abcd1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
NOS1AP (Carboxyl-terminal PDZ Ligand of Neuronal Nitric Oxide Synthase Protein, Nitric Oxide Synthase 1 Adaptor Protein)
487046 100 µL

NOS1AP (Carboxyl-terminal PDZ Ligand of Neuronal Nitric Oxide Synthase Protein, Nitric Oxide Synthase 1 Adaptor Protein)

Sign In for Pricing
View Details
AKR7A3 ORF Vector (Human) (pORF)
ORF000314 1.0 µg DNA

AKR7A3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details