Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yipf5 Rabbit Polyclonal Antibody (FITC)

Yipf5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Yi, Yip1a, AA408236, 2610311I19Rik

UniProt

Q9WUU7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DMMQPQQTYTGQIYQPTQAYPPTTPQPFYGDSFEEEPPLLEELGINFDHI

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_071720

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HnRNP Q, CT (Heterogeneous Nuclear Ribonucleoprotein Q, Glycine- and Tyrosine-rich RNA-binding Protein, GRY-RBP, NS1-associated Protein 1, Synaptotagmin-binding, Cytoplasmic RNA-interacting Protein, SYNCRIP, HNRPQ, NSAP1) discontinued
H6285-65C 50 µg

HnRNP Q, CT (Heterogeneous Nuclear Ribonucleoprotein Q, Glycine- and Tyrosine-rich RNA-binding Protein, GRY-RBP, NS1-associated Protein 1, Synaptotagmin-binding, Cytoplasmic RNA-interacting Protein, SYNCRIP, HNRPQ, NSAP1) discontinued

Sign In for Pricing
View Details
Recombinant Human SF3B3 Protein, N-His
ARO-P12310-01 50 µg

Recombinant Human SF3B3 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human SF3B3 Protein, N-His
ARO-P12310-02 100 µg

Recombinant Human SF3B3 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human SF3B3 Protein, N-His
ARO-P12310-03 1 mg

Recombinant Human SF3B3 Protein, N-His

Sign In for Pricing
View Details
AMHR2 Rabbit Polyclonal Antibody (APC-Cy7)
orb2418989 100 µL

AMHR2 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Rat RAC-beta serine/threonine-protein kinase, Akt2 ELISA Kit
MBS1611702-01 48 Well

Rat RAC-beta serine/threonine-protein kinase, Akt2 ELISA Kit

Sign In for Pricing
View Details