Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yipf5 Rabbit Polyclonal Antibody (FITC)

Yipf5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Yi, Yip1a, AA408236, 2610311I19Rik

UniProt

Q9WUU7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DMMQPQQTYTGQIYQPTQAYPPTTPQPFYGDSFEEEPPLLEELGINFDHI

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_071720

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1107 ORF Vector (Mouse) (pORF)
ORF052052 1.0 µg DNA

Olfr1107 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
CD7, Cynomolgus (HEK293, His)
HY-P7808-01 10 µg

CD7, Cynomolgus (HEK293, His)

Sign In for Pricing
View Details
CD7, Cynomolgus (HEK293, His)
HY-P7808-02 50 µg

CD7, Cynomolgus (HEK293, His)

Sign In for Pricing
View Details
Polyclonal Antibody to Acyl Coenzyme A Oxidase 2, Branched (ACOX2)
TRV-0058532-01 20 µL

Polyclonal Antibody to Acyl Coenzyme A Oxidase 2, Branched (ACOX2)

Sign In for Pricing
View Details
Polyclonal Antibody to Acyl Coenzyme A Oxidase 2, Branched (ACOX2)
TRV-0058532-02 100 µL

Polyclonal Antibody to Acyl Coenzyme A Oxidase 2, Branched (ACOX2)

Sign In for Pricing
View Details
Polyclonal Antibody to Acyl Coenzyme A Oxidase 2, Branched (ACOX2)
TRV-0058532-03 200 µL

Polyclonal Antibody to Acyl Coenzyme A Oxidase 2, Branched (ACOX2)

Sign In for Pricing
View Details