Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yipf5 Rabbit Polyclonal Antibody (HRP)

Yipf5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Yi, Yip1a, AA408236, 2610311I19Rik

UniProt

Q9WUU7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DMMQPQQTYTGQIYQPTQAYPPTTPQPFYGDSFEEEPPLLEELGINFDHI

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_071720

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

eIF4E Rabbit mAb
MBS4761541-01 0.1 mL

eIF4E Rabbit mAb

Sign In for Pricing
View Details
eIF4E Rabbit mAb
MBS4761541-02 5x 0.1 mL

eIF4E Rabbit mAb

Sign In for Pricing
View Details
MST4 Recombinant Antibody, PE-Cy5.5 Conjugated
bsm-62695R-PE-Cy5.5 100 µL

MST4 Recombinant Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Gnl1 Rabbit Polyclonal Antibody
orb582461 100 µL

Gnl1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TFDP1 Antibody
OACA06681-100UL 100 µL

TFDP1 Antibody

Sign In for Pricing
View Details
Mouse Ankyrin repeat and BTB/POZ domain containing protein 2 (ABTB2) ELISA Kit
GTR10313804 96 Well

Mouse Ankyrin repeat and BTB/POZ domain containing protein 2 (ABTB2) ELISA Kit

Sign In for Pricing
View Details