Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFITM5 Rabbit Polyclonal Antibody (Biotin)

IFITM5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OI5, BRIL, DSPA1, Hrmp1, fragilis4

UniProt

A6NNB3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IFITM5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAAFFSTKFDDADY

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001020466

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Lce1i shRNA (UAS) - Lentiviral mouse Lce1i shRNA (UAS, iRFP) (25)
GTR15292742 1 Vial

Lentiviral mouse Lce1i shRNA (UAS) - Lentiviral mouse Lce1i shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Acetyl Coenzyme A Carboxylase Alpha (ACACa) Magnetic Fluorescence Assay Kit
MBS2157175-01 96 Tests

Acetyl Coenzyme A Carboxylase Alpha (ACACa) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Acetyl Coenzyme A Carboxylase Alpha (ACACa) Magnetic Fluorescence Assay Kit
MBS2157175-02 5x 96 Tests

Acetyl Coenzyme A Carboxylase Alpha (ACACa) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Acetyl Coenzyme A Carboxylase Alpha (ACACa) Magnetic Fluorescence Assay Kit
MBS2157175-03 10x 96 Tests

Acetyl Coenzyme A Carboxylase Alpha (ACACa) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Recombinant Human CMBL Protein (His Tag)
PKSH031130 100 µg

Recombinant Human CMBL Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Bordetella petrii Pantothenate synthetase (panC)
MBS1032878-01 0.02 mg (E-Coli)

Recombinant Bordetella petrii Pantothenate synthetase (panC)

Sign In for Pricing
View Details