Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFITM5 Rabbit Polyclonal Antibody (HRP)

IFITM5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OI5, BRIL, DSPA1, Hrmp1, fragilis4

UniProt

A6NNB3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IFITM5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAAFFSTKFDDADY

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001020466

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM10 Double Nickase Plasmid (m)
sc-427597-NIC 20 µg

MCM10 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
2'-Deoxyuridine-5'-triphosphate Trisodium Salt >90% (contains ammonium salt)
TRC-D288038-100MG 100 mg

2'-Deoxyuridine-5'-triphosphate Trisodium Salt >90% (contains ammonium salt)

Sign In for Pricing
View Details
Lentiviral mouse Pgk1 shRNA (UAS) - Lentiviral mouse Pgk1 shRNA (UAS) plasmid
GTR15172543 1 Vial

Lentiviral mouse Pgk1 shRNA (UAS) - Lentiviral mouse Pgk1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Anti-UQCRC2 Antibody (R1S15)
RHD53901 100 μg

Anti-UQCRC2 Antibody (R1S15)

Sign In for Pricing
View Details
Rabbit Polyclonal PRAGMIN Antibody
NBP1-42689 0.1 mL

Rabbit Polyclonal PRAGMIN Antibody

Sign In for Pricing
View Details
Kcnq3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
25422116 3x 1.0 µg

Kcnq3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details