Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ano6 Rabbit Polyclonal Antibody (Biotin)

Ano6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Tmem16f, AA407480, AW554778, 2900059G15Rik, F730003B03Rik

UniProt

Q6P9J9

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SVFIVFSTTLPKNPNGTDPIQKYLTPQMATSITASIISFIIIMILNTIYE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

106kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_780553

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFRS1, CT (Splicing Factor, Arginine/Serine-rich 1, pre-mRNA-splicing Factor SF2, P33 Subunit, Alternative-splicing Factor 1, ASF-1, OK/SW-cl.3, SF2P33, SF2, ASF) (APC)
MBS6500514-01 0.2 mL

SFRS1, CT (Splicing Factor, Arginine/Serine-rich 1, pre-mRNA-splicing Factor SF2, P33 Subunit, Alternative-splicing Factor 1, ASF-1, OK/SW-cl.3, SF2P33, SF2, ASF) (APC)

Sign In for Pricing
View Details
SFRS1, CT (Splicing Factor, Arginine/Serine-rich 1, pre-mRNA-splicing Factor SF2, P33 Subunit, Alternative-splicing Factor 1, ASF-1, OK/SW-cl.3, SF2P33, SF2, ASF) (APC)
MBS6500514-02 5x 0.2 mL

SFRS1, CT (Splicing Factor, Arginine/Serine-rich 1, pre-mRNA-splicing Factor SF2, P33 Subunit, Alternative-splicing Factor 1, ASF-1, OK/SW-cl.3, SF2P33, SF2, ASF) (APC)

Sign In for Pricing
View Details
Card9 AAV siRNA Pooled Vector
15039164 1.0 µg

Card9 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Histone H1.2 Antibody (YA383, Rabbit)
HY-P80158-01 10 µL

Histone H1.2 Antibody (YA383, Rabbit)

Sign In for Pricing
View Details
Histone H1.2 Antibody (YA383, Rabbit)
HY-P80158-02 50 μL

Histone H1.2 Antibody (YA383, Rabbit)

Sign In for Pricing
View Details
Histone H1.2 Antibody (YA383, Rabbit)
HY-P80158-03 100 µL

Histone H1.2 Antibody (YA383, Rabbit)

Sign In for Pricing
View Details