Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ano6 Rabbit Polyclonal Antibody (HRP)

Ano6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Tmem16f, AA407480, AW554778, 2900059G15Rik, F730003B03Rik

UniProt

Q6P9J9

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SVFIVFSTTLPKNPNGTDPIQKYLTPQMATSITASIISFIIIMILNTIYE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

106kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_780553

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 Tumor Suppressor Protein (TP53/3156R), CF568 conjugate, 0.1mg/mL
BNC683156-100 1x 100 µL

P53 Tumor Suppressor Protein (TP53/3156R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), CF640R conjugate, 0.1mg/mL
BNC401887-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX2 (Transcription Factor) (SOX2/1791), 0.2mg/mL
BNUB1791-500 1x 500 µL

SOX2 (Transcription Factor) (SOX2/1791), 0.2mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), 0.2mg/mL
BNUB0225-100 1x 100 µL

Major Vault Protein (MVP) (1032), 0.2mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), 0.2mg/mL
BNUB0257-500 1x 500 µL

Cytokeratin, HMW (AE-3), 0.2mg/mL

Sign In for Pricing
View Details
AITR Human
OM296926-01 10 µg

AITR Human

Sign In for Pricing
View Details