Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLD3 Rabbit Polyclonal Antibody (Biotin)

PLD3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AD19, HUK4, HU-K4, SCA46

UniProt

Q8IV08

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PLD3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: WVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVE

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001026866

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTF2H3 Human qPCR Template Standard (NM_001516)
HK203567 1 Kit

GTF2H3 Human qPCR Template Standard (NM_001516)

Sign In for Pricing
View Details
LRRC30 HDR Plasmid (h)
sc-415511-HDR 20 µg

LRRC30 HDR Plasmid (h)

Sign In for Pricing
View Details
Recombinant Roseiflexus castenholzii Pyridoxal biosynthesis lyase pdxS (pdxS)
MBS1065960-01 0.02 mg (E-Coli)

Recombinant Roseiflexus castenholzii Pyridoxal biosynthesis lyase pdxS (pdxS)

Sign In for Pricing
View Details
Recombinant Roseiflexus castenholzii Pyridoxal biosynthesis lyase pdxS (pdxS)
MBS1065960-02 0.02 mg (Yeast)

Recombinant Roseiflexus castenholzii Pyridoxal biosynthesis lyase pdxS (pdxS)

Sign In for Pricing
View Details
Recombinant Roseiflexus castenholzii Pyridoxal biosynthesis lyase pdxS (pdxS)
MBS1065960-03 0.1 mg (E-Coli)

Recombinant Roseiflexus castenholzii Pyridoxal biosynthesis lyase pdxS (pdxS)

Sign In for Pricing
View Details
Recombinant Roseiflexus castenholzii Pyridoxal biosynthesis lyase pdxS (pdxS)
MBS1065960-04 0.1 mg (Yeast)

Recombinant Roseiflexus castenholzii Pyridoxal biosynthesis lyase pdxS (pdxS)

Sign In for Pricing
View Details