Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLD3 Rabbit Polyclonal Antibody (HRP)

PLD3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AD19, HUK4, HU-K4, SCA46

UniProt

Q8IV08

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PLD3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PNASTGNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPSAQQGE

Field of Research

Metabolism Research

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_006723187

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

HES1 sgRNA CRISPR Lentivector (Human) (Target 1)
K0946902 1.0 µg DNA

HES1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
SLC38A1 Human shRNA Lentiviral Particle (Locus ID 81539)
TL301578V 500 µL Each

SLC38A1 Human shRNA Lentiviral Particle (Locus ID 81539)

Sign In for Pricing
View Details
SHC Adaptor Protein 1 Phospho-Tyr427 (SHC1 pY427) Antibody
abx333216 100 µL

SHC Adaptor Protein 1 Phospho-Tyr427 (SHC1 pY427) Antibody

Sign In for Pricing
View Details
3- (4- (1,3-dioxoisoindolin-2-yl) butyl) -1H-indole-5-carbonitrile
OR85641-01 100 mg

3- (4- (1,3-dioxoisoindolin-2-yl) butyl) -1H-indole-5-carbonitrile

Sign In for Pricing
View Details
3- (4- (1,3-dioxoisoindolin-2-yl) butyl) -1H-indole-5-carbonitrile
OR85641-02 250 mg

3- (4- (1,3-dioxoisoindolin-2-yl) butyl) -1H-indole-5-carbonitrile

Sign In for Pricing
View Details
3- (4- (1,3-dioxoisoindolin-2-yl) butyl) -1H-indole-5-carbonitrile
OR85641-03 1 g

3- (4- (1,3-dioxoisoindolin-2-yl) butyl) -1H-indole-5-carbonitrile

Sign In for Pricing
View Details