Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1orf151 Rabbit Polyclonal Antibody (HRP)

C1orf151 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MIO10, Mic10, MINOS1, C1orf151

UniProt

Q5TGZ0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C1orf151

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

9kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001027535

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEFB112 Rabbit Polyclonal Antibody (PE)
orb493779 100 µL

DEFB112 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Fam60a (Sinhcaf) (NM_001134712) Rat Tagged ORF Clone Lentiviral Particle
RR200008L3V 200 µL

Fam60a (Sinhcaf) (NM_001134712) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
M6-125-175-342-OR Pre-sized Sleeves for Printers
173607 100 Roll (100 Sleeve (s) x 1 Roll)

M6-125-175-342-OR Pre-sized Sleeves for Printers

Sign In for Pricing
View Details
CD200 recombinant monoclonal antibody (333)
ENZ-ABS966-0100 100 µL

CD200 recombinant monoclonal antibody (333)

Sign In for Pricing
View Details
Human CUB and sushi domain-containing protein 1 (CSMD1) ELISA Kit
201-12-5885 96 Tests

Human CUB and sushi domain-containing protein 1 (CSMD1) ELISA Kit

Sign In for Pricing
View Details
CPS1 sgRNA CRISPR Lentivector (Human) (Target 1)
K0501702 1.0 µg DNA

CPS1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details