Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP48 Rabbit Polyclonal Antibody (Biotin)

USP48 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

USP31, RAP1GA1

UniProt

Q86UV5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human USP48

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NTFLQVWFLNLELRQALYLCPSTCSDYMLGDGIQEEKDYEPQTICEHLQY

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001027902.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ki67 Antibody
orb1331877 100 µg

Ki67 Antibody

Sign In for Pricing
View Details
Rat Cirbp Pre-designed siRNA Set A
SI202801A 1 Each

Rat Cirbp Pre-designed siRNA Set A

Sign In for Pricing
View Details
RARB, ID (RARB, HAP, NR1B2, Retinoic acid receptor beta, HBV-activated protein, Nuclear receptor subfamily 1 group B member 2, RAR-epsilon) (MaxLight 750)
MBS6340326-01 0.1 mL

RARB, ID (RARB, HAP, NR1B2, Retinoic acid receptor beta, HBV-activated protein, Nuclear receptor subfamily 1 group B member 2, RAR-epsilon) (MaxLight 750)

Sign In for Pricing
View Details
RARB, ID (RARB, HAP, NR1B2, Retinoic acid receptor beta, HBV-activated protein, Nuclear receptor subfamily 1 group B member 2, RAR-epsilon) (MaxLight 750)
MBS6340326-02 5x 0.1 mL

RARB, ID (RARB, HAP, NR1B2, Retinoic acid receptor beta, HBV-activated protein, Nuclear receptor subfamily 1 group B member 2, RAR-epsilon) (MaxLight 750)

Sign In for Pricing
View Details
C15orf58 3'UTR GFP Stable Cell Line
TU052978 1.0 mL

C15orf58 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Pin1rt1 shRNA (UAS) - Lentiviral mouse Pin1rt1 shRNA (UAS, RFP) (100)
GTR15211464 1 Vial

Lentiviral mouse Pin1rt1 shRNA (UAS) - Lentiviral mouse Pin1rt1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details