Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERP29 Rabbit Polyclonal Antibody (HRP)

ERP29 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ERp28, ERp31, PDIA9, PDI-DB, C12orf8, HEL-S-107

UniProt

P30040

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ERP29

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVI

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

IHC, WB

NCBI Accession Number

NP_006808

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Gsh1 (GSX1) activation kit by CRISPRa
GA116477 1 Kit

Human Gsh1 (GSX1) activation kit by CRISPRa

Sign In for Pricing
View Details
HMGCLL1 (NM_001042406) Human Over-expression Lysate
LC420884 20 µg

HMGCLL1 (NM_001042406) Human Over-expression Lysate

Sign In for Pricing
View Details
Serine racemase (SRR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9E8]
TA500949AM 100 µL

Serine racemase (SRR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9E8]

Sign In for Pricing
View Details
Biotin Conjugated Goat Affinity Purified Antibody to Mouse IgG,
BAF-011-2 2 mL

Biotin Conjugated Goat Affinity Purified Antibody to Mouse IgG,

Sign In for Pricing
View Details
SAV1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B7]
TA804764BM 100 µL

SAV1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B7]

Sign In for Pricing
View Details
MUC15 (C-term) Rabbit Polyclonal Antibody
AP52773PU-N 400 µL

MUC15 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details