Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RETREG1 Rabbit Polyclonal Antibody (Biotin)

RETREG1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

JK1, JK-1, FAM134B

UniProt

Q9H6L5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FAM134B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DFGIGEYINQKKRERSEADKEKSHKDDSELDFSALCPKISLTVAAKELSV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_001030022

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Linked Polyclonal Antibody to Macrophage Scavenger Receptor 1 (MSR1)
MBS2133412-01 0.1 mL

PE Linked Polyclonal Antibody to Macrophage Scavenger Receptor 1 (MSR1)

Sign In for Pricing
View Details
PE Linked Polyclonal Antibody to Macrophage Scavenger Receptor 1 (MSR1)
MBS2133412-02 0.2 mL

PE Linked Polyclonal Antibody to Macrophage Scavenger Receptor 1 (MSR1)

Sign In for Pricing
View Details
PE Linked Polyclonal Antibody to Macrophage Scavenger Receptor 1 (MSR1)
MBS2133412-03 0.5 mL

PE Linked Polyclonal Antibody to Macrophage Scavenger Receptor 1 (MSR1)

Sign In for Pricing
View Details
PE Linked Polyclonal Antibody to Macrophage Scavenger Receptor 1 (MSR1)
MBS2133412-04 1 mL

PE Linked Polyclonal Antibody to Macrophage Scavenger Receptor 1 (MSR1)

Sign In for Pricing
View Details
PE Linked Polyclonal Antibody to Macrophage Scavenger Receptor 1 (MSR1)
MBS2133412-05 5 mL

PE Linked Polyclonal Antibody to Macrophage Scavenger Receptor 1 (MSR1)

Sign In for Pricing
View Details
PE Linked Polyclonal Antibody to Macrophage Scavenger Receptor 1 (MSR1)
MBS2133412-06 5x 5 mL

PE Linked Polyclonal Antibody to Macrophage Scavenger Receptor 1 (MSR1)

Sign In for Pricing
View Details