Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RETREG1 Rabbit Polyclonal Antibody (HRP)

RETREG1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

JK1, JK-1, FAM134B

UniProt

Q9H6L5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FAM134B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSVSDTDVSEVSWTDNGTFNLSEGYTPQTDTSDDLDRPSEEVFSRDLSDF

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_061873

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA-PKcs/PRKDC Mouse Monoclonal Antibody [2-B3]
M1204-6 100 µL

DNA-PKcs/PRKDC Mouse Monoclonal Antibody [2-B3]

Sign In for Pricing
View Details
Sclerostin (SOST) (N-term) Rabbit Polyclonal Antibody
AP13235PU-N 200 µL

Sclerostin (SOST) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
L-Menthyl Lactate
TRC-M220795-1G 1 g

L-Menthyl Lactate

Sign In for Pricing
View Details
2X One-Step RT-PCR Master Mix-100p
28113 100 Reactions

2X One-Step RT-PCR Master Mix-100p

Sign In for Pricing
View Details
Aurora B (Proliferation Marker) (rAURKB/1592), Biotin conjugate, 0.1mg/mL
BNCB3787-100 1x 100 µL

Aurora B (Proliferation Marker) (rAURKB/1592), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CYBA (NM_000101) Human Over-expression Lysate
LC400029 20 µg

CYBA (NM_000101) Human Over-expression Lysate

Sign In for Pricing
View Details