Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-17, Human

FGF-17 Protein plays a crucial role in embryonic development, serving as a signaling molecule for brain induction and patterning. Its presence is vital for normal brain development, emphasizing its significance in shaping embryogenesis intricacies. FGF-17 interacts with FGFR3 and FGFR4, underscoring its involvement in signaling cascades that precisely orchestrate developmental events in the embryonic brain. FGF-17 Protein, Human is the recombinant human-derived FGF-17 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-17 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-17-protein-human-194aa.html

Purity

95.0

Smiles

TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Molecular Formula

8822 (Gene_ID) O60258 (T23-T216) (Accession)

Molecular Weight

Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Arachis hypogaea Lectin (Peanut) -PNA-,  40nm
GP-2301-40 1 mL

Colloidal Gold Conjugated Arachis hypogaea Lectin (Peanut) -PNA-, 40nm

Sign In for Pricing
View Details
Apoe Rabbit Polyclonal Antibody
TA373601 100 µL

Apoe Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD44 Standard (HCAM/918), CF594 conjugate, 0.1mg/mL
BNC940918-500 1x 500 µL

CD44 Standard (HCAM/918), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nectin-4/NECTIN4 Polyclonal Antibody
AN006920L-01 25 µL

Nectin-4/NECTIN4 Polyclonal Antibody

Sign In for Pricing
View Details
Nectin-4/NECTIN4 Polyclonal Antibody
AN006920L-02 100 µL

Nectin-4/NECTIN4 Polyclonal Antibody

Sign In for Pricing
View Details
SCN1A Polyclonal Antibody
E-AB-16049-01 20 µL

SCN1A Polyclonal Antibody

Sign In for Pricing
View Details