Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-17, Human

FGF-17 Protein plays a crucial role in embryonic development, serving as a signaling molecule for brain induction and patterning. Its presence is vital for normal brain development, emphasizing its significance in shaping embryogenesis intricacies. FGF-17 interacts with FGFR3 and FGFR4, underscoring its involvement in signaling cascades that precisely orchestrate developmental events in the embryonic brain. FGF-17 Protein, Human is the recombinant human-derived FGF-17 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-17 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-17-protein-human-194aa.html

Purity

95.0

Smiles

TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Molecular Formula

8822 (Gene_ID) O60258 (T23-T216) (Accession)

Molecular Weight

Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serpina7 Rabbit Polyclonal Antibody
TA363029 100 µL

Serpina7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® 700 Mouse IgG1, κ Isotype Control[MOPC-21]
E-AB-F09792M1-01 20 Tests

Elab Fluor® 700 Mouse IgG1, κ Isotype Control[MOPC-21]

Sign In for Pricing
View Details
Elab Fluor® 700 Mouse IgG1, κ Isotype Control[MOPC-21]
E-AB-F09792M1-02 100 Tests

Elab Fluor® 700 Mouse IgG1, κ Isotype Control[MOPC-21]

Sign In for Pricing
View Details
Elab Fluor® 700 Mouse IgG1, κ Isotype Control[MOPC-21]
E-AB-F09792M1-03 2x 100 Tests

Elab Fluor® 700 Mouse IgG1, κ Isotype Control[MOPC-21]

Sign In for Pricing
View Details
Human FBXO43 activation kit by CRISPRa
GA117280 1 Kit

Human FBXO43 activation kit by CRISPRa

Sign In for Pricing
View Details
IL-1 beta Antibody (HRP)
KH-408-01 50 μL

IL-1 beta Antibody (HRP)

Sign In for Pricing
View Details