Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRCAM Rabbit Polyclonal Antibody (FITC)

NRCAM Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KIAA0343, MGC138845, MGC138846

UniProt

Q92823

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NRCAM

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTP

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

141kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_001032209

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C5b antibody
10R-C142A 0.05 mg

Complement C5b antibody

Sign In for Pricing
View Details
STAT1 Polyclonal Antibody, Cy5.5 Conjugated
bs-1317R-Cy5.5 100 µL

STAT1 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Aph 1b (APH1B) (NM_001145646) Human Tagged Lenti ORF Clone
RC226500L4 10 µg

Aph 1b (APH1B) (NM_001145646) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
UBXN1 Recombinant Protein (Mouse)
RP182876 100 µg

UBXN1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
XRCC6BP1 (Mitochondrial Inner Membrane Protease ATP23 Homolog, Ku70-binding Protein 3, XRCC6-binding Protein 1, KUB3, MGC134817, MGC134818) (MaxLight 750)
MBS6398830-01 0.1 mL

XRCC6BP1 (Mitochondrial Inner Membrane Protease ATP23 Homolog, Ku70-binding Protein 3, XRCC6-binding Protein 1, KUB3, MGC134817, MGC134818) (MaxLight 750)

Sign In for Pricing
View Details
XRCC6BP1 (Mitochondrial Inner Membrane Protease ATP23 Homolog, Ku70-binding Protein 3, XRCC6-binding Protein 1, KUB3, MGC134817, MGC134818) (MaxLight 750)
MBS6398830-02 5x 0.1 mL

XRCC6BP1 (Mitochondrial Inner Membrane Protease ATP23 Homolog, Ku70-binding Protein 3, XRCC6-binding Protein 1, KUB3, MGC134817, MGC134818) (MaxLight 750)

Sign In for Pricing
View Details