Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALC Rabbit Polyclonal Antibody (FITC)

GALC Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P54803

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GALC

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVAL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000144

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-HIV1 Surface protein gp120 Nanobody (SAA0884)
RVV03104 100 μg

Anti-HIV1 Surface protein gp120 Nanobody (SAA0884)

Sign In for Pricing
View Details
Lentiviral human C9orf72 sgRNA gene knockout kit - Lentiviral human C9orf72 sgRNA gene knockout kit (100)
GTR15362164 1 Vial

Lentiviral human C9orf72 sgRNA gene knockout kit - Lentiviral human C9orf72 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
PLCD3 Rabbit Polyclonal Antibody (PE)
orb2588593 100 µg

PLCD3 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Mycobacterium bovis bacterial protein
orb2942610 500 µg

Mycobacterium bovis bacterial protein

Sign In for Pricing
View Details
HASPIN Rabbit Polyclonal Antibody (HRP)
orb2097209 100 µL

HASPIN Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Guinea pig Mediator of RNA polymerase II transcription subunit 14 (MED14) ELISA Kit
MBS7220414-01 48 Well

Guinea pig Mediator of RNA polymerase II transcription subunit 14 (MED14) ELISA Kit

Sign In for Pricing
View Details