Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALC Rabbit Polyclonal Antibody (FITC)

GALC Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P54803

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GALC

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVAL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000144

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human OXR1 Polyclonal Antibody
HP739014-01 50 µg

Anti-Human OXR1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human OXR1 Polyclonal Antibody
HP739014-02 100 µg

Anti-Human OXR1 Polyclonal Antibody

Sign In for Pricing
View Details
Goat Chemokine Like Factor Superfamily 5 ELISA Kit
MBS745985-01 48 Well

Goat Chemokine Like Factor Superfamily 5 ELISA Kit

Sign In for Pricing
View Details
Goat Chemokine Like Factor Superfamily 5 ELISA Kit
MBS745985-02 96 Well

Goat Chemokine Like Factor Superfamily 5 ELISA Kit

Sign In for Pricing
View Details
Goat Chemokine Like Factor Superfamily 5 ELISA Kit
MBS745985-03 5x 96 Well

Goat Chemokine Like Factor Superfamily 5 ELISA Kit

Sign In for Pricing
View Details
Goat Chemokine Like Factor Superfamily 5 ELISA Kit
MBS745985-04 10x 96 Well

Goat Chemokine Like Factor Superfamily 5 ELISA Kit

Sign In for Pricing
View Details