Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B3GALNT1 Rabbit Polyclonal Antibody (Biotin)

B3GALNT1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P, P1, GLOB, GLCT3, galT3, Gb4Cer, B3GALT3, beta3Gal-T3

UniProt

O75752

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human B3GALNT1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLFFLYRIHLDVC

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001033717

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCF4 (NM_001083962) Human Over-expression Lysate
LY421261 100 µg

TCF4 (NM_001083962) Human Over-expression Lysate

Sign In for Pricing
View Details
Sptlc2 Mouse Gene Knockout Kit (CRISPR)
KN516687 1 Kit

Sptlc2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/2571R), CF640R conjugate, 0.1mg/mL
BNC402571-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/2571R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RIOK2 Human Gene Knockout Kit (CRISPR)
KN401484 1 Kit

RIOK2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS713890 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS621124 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details