Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HEPACAM2 Rabbit Polyclonal Antibody (HRP)

HEPACAM2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MIKI

UniProt

A8MVW5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LOC253012

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NYSCLVRNPVSEMESDIIMPIIYYGPYGLQVNSDKGLKVGEVFTVDLGEA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001034461

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZMAT3 Antibody
orb682342 100 µL

ZMAT3 Antibody

Sign In for Pricing
View Details
PIK3R2 (Phosphatidylinositol 3-kinase Regulatory Subunit beta, PI3-kinase Regulatory Subunit beta, PI3K Regulatory Subunit beta, PtdIns-3-kinase Regulatory Subunit beta, Phosphatidylinositol 3-kinase 85kD Regulatory Subunit beta, PI3-kinase Subunit p85-beta, PtdIns-3-kinase Regulatory Subunit p85-beta)
P4073-30M1 100 µg

PIK3R2 (Phosphatidylinositol 3-kinase Regulatory Subunit beta, PI3-kinase Regulatory Subunit beta, PI3K Regulatory Subunit beta, PtdIns-3-kinase Regulatory Subunit beta, Phosphatidylinositol 3-kinase 85kD Regulatory Subunit beta, PI3-kinase Subunit p85-beta, PtdIns-3-kinase Regulatory Subunit p85-beta)

Sign In for Pricing
View Details
p38 MAPK (Phospho-Tyr322) Antibody
MBS9414705-01 0.05 mL

p38 MAPK (Phospho-Tyr322) Antibody

Sign In for Pricing
View Details
p38 MAPK (Phospho-Tyr322) Antibody
MBS9414705-02 0.1 mL

p38 MAPK (Phospho-Tyr322) Antibody

Sign In for Pricing
View Details
p38 MAPK (Phospho-Tyr322) Antibody
MBS9414705-03 5x 0.1 mL

p38 MAPK (Phospho-Tyr322) Antibody

Sign In for Pricing
View Details
Recombinant Treponema pallidum (TP-15KD) antigen
orb1676806 1 mg

Recombinant Treponema pallidum (TP-15KD) antigen

Sign In for Pricing
View Details