Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atp6v0b Rabbit Polyclonal Antibody (HRP)

Atp6v0b Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Atp6v0bl1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Atp6v0b

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PSNNLFCPSQPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001100151

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smoothelin Overexpression Lysate (Native) - (Dry Ice)
NBP2-05688 0.1 mg

Smoothelin Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Calu-3/NF-kB Reporter (Luc) stable cell line
GTR15424134 1 Vial

Calu-3/NF-kB Reporter (Luc) stable cell line

Sign In for Pricing
View Details
ELISA kit for Mouse GDF1 (Growth Differentiation Factor 1)
E-EL-M0596 96 Tests

ELISA kit for Mouse GDF1 (Growth Differentiation Factor 1)

Sign In for Pricing
View Details
ASAH1 Peptide
4741P 0.05 mg

ASAH1 Peptide

Sign In for Pricing
View Details
Plant Paraneoplastic Antigen MA2 Antibody (Anti-PNMA2) ELISA Kit
MBS9372469 Inquire

Plant Paraneoplastic Antigen MA2 Antibody (Anti-PNMA2) ELISA Kit

Sign In for Pricing
View Details
MEGF8 Human shRNA Plasmid Kit (Locus ID 1954)
TR311509 1 Kit

MEGF8 Human shRNA Plasmid Kit (Locus ID 1954)

Sign In for Pricing
View Details