Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atp6v0b Rabbit Polyclonal Antibody (HRP)

Atp6v0b Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Atp6v0bl1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Atp6v0b

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PSNNLFCPSQPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001100151

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPT16 Antibody, Biotin conjugated
CSB-PA022955LD01DOA-01 50 µg

SPT16 Antibody, Biotin conjugated

Sign In for Pricing
View Details
SPT16 Antibody, Biotin conjugated
CSB-PA022955LD01DOA-02 100 µg

SPT16 Antibody, Biotin conjugated

Sign In for Pricing
View Details
CFI (light chain) Blocking Peptide (C-term)
MBS9230286-01 0.5 mg

CFI (light chain) Blocking Peptide (C-term)

Sign In for Pricing
View Details
CFI (light chain) Blocking Peptide (C-term)
MBS9230286-02 5x 0.5 mg

CFI (light chain) Blocking Peptide (C-term)

Sign In for Pricing
View Details
KCNJ11 Rabbit Polyclonal Antibody
orb575394 100 µL

KCNJ11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SKIL siRNA (Human)
MBS826904-01 15 nmol

SKIL siRNA (Human)

Sign In for Pricing
View Details