Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHIC1 Rabbit Polyclonal Antibody (FITC)

CHIC1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BRX

UniProt

Q5JSZ4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CHIC1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLTGKVAPEEFKTSIGRV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001034929

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

AAMDC Knockout 786-O Polyclonal Cells
ARG24754 1 Million

AAMDC Knockout 786-O Polyclonal Cells

Sign In for Pricing
View Details
MTX1 Rabbit Polyclonal Antibody
orb185365-01 50 μL

MTX1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MTX1 Rabbit Polyclonal Antibody
orb185365-02 100 µL

MTX1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MTX1 Rabbit Polyclonal Antibody
orb185365-03 200 µL

MTX1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FOXO4 Rabbit Polyclonal Antibody (FITC)
orb8902 100 µL

FOXO4 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
SCNN1B, ID (SCNN1B, Amiloride-sensitive sodium channel subunit beta, Beta-NaCH, Epithelial Na (+) channel subunit beta, Nonvoltage-gated sodium channel 1 subunit beta, SCNEB) (MaxLight 750) discontinued
041467-ML750 100 µL

SCNN1B, ID (SCNN1B, Amiloride-sensitive sodium channel subunit beta, Beta-NaCH, Epithelial Na (+) channel subunit beta, Nonvoltage-gated sodium channel 1 subunit beta, SCNEB) (MaxLight 750) discontinued

Sign In for Pricing
View Details