Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C19orf46 Rabbit Polyclonal Antibody (Biotin)

C19orf46 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KASH4, Nesp4, DFNB76, C19orf46

UniProt

Q8N205

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C19orf46

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GEESTSPEQAQTLGQDSLGPPEHFQGGPRGNEPAAHPPRWSTPSSYEDPA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_001034965

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Hoxc8 qPCR Primer Pair
QM14894S 200 Tests

Mouse Hoxc8 qPCR Primer Pair

Sign In for Pricing
View Details
Transforming Growth Factor Beta 1 (TGFb1) Antibody
abx170047 1 mL

Transforming Growth Factor Beta 1 (TGFb1) Antibody

Sign In for Pricing
View Details
DMTr-2'-F-dG (iBu) -3'-CE-Phosphoramidite
PA022-100 100 g

DMTr-2'-F-dG (iBu) -3'-CE-Phosphoramidite

Sign In for Pricing
View Details
JMJD6, CT (JMJD6, KIAA0585, PTDSR, Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6, Histone arginine demethylase JMJD6, JmjC domain-containing protein 6, Jumonji domain-containing protein 6, Lysyl-hydroxylase JMJD6, Peptide-lysine 5-dioxygenase JMJD6, Phosphatidylserine receptor) (Biotin) discontinued
037209-Biotin 200 µL

JMJD6, CT (JMJD6, KIAA0585, PTDSR, Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6, Histone arginine demethylase JMJD6, JmjC domain-containing protein 6, Jumonji domain-containing protein 6, Lysyl-hydroxylase JMJD6, Peptide-lysine 5-dioxygenase JMJD6, Phosphatidylserine receptor) (Biotin) discontinued

Sign In for Pricing
View Details
EAF6 rabbit pAb
RA24402-01 50 µL

EAF6 rabbit pAb

Sign In for Pricing
View Details
EAF6 rabbit pAb
RA24402-02 100 µL

EAF6 rabbit pAb

Sign In for Pricing
View Details