Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C19orf46 Rabbit Polyclonal Antibody (HRP)

C19orf46 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KASH4, Nesp4, DFNB76, C19orf46

UniProt

Q8N205

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C19orf46

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GEESTSPEQAQTLGQDSLGPPEHFQGGPRGNEPAAHPPRWSTPSSYEDPA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_001034965

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ebola virus EBOV (Subtype Sudan, strain Gulu) Glycoprotein/GP Insect Cell Lysate (WB positive control)
MBS8115832-01 0.3 mg

Ebola virus EBOV (Subtype Sudan, strain Gulu) Glycoprotein/GP Insect Cell Lysate (WB positive control)

Sign In for Pricing
View Details
Ebola virus EBOV (Subtype Sudan, strain Gulu) Glycoprotein/GP Insect Cell Lysate (WB positive control)
MBS8115832-02 5x 0.3 mg

Ebola virus EBOV (Subtype Sudan, strain Gulu) Glycoprotein/GP Insect Cell Lysate (WB positive control)

Sign In for Pricing
View Details
Human Lactase (LCT) ELISA Kit
MBS4503560-01 48 Tests

Human Lactase (LCT) ELISA Kit

Sign In for Pricing
View Details
Human Lactase (LCT) ELISA Kit
MBS4503560-02 96 Tests

Human Lactase (LCT) ELISA Kit

Sign In for Pricing
View Details
Human Lactase (LCT) ELISA Kit
MBS4503560-03 5x 96 Tests

Human Lactase (LCT) ELISA Kit

Sign In for Pricing
View Details
Human Lactase (LCT) ELISA Kit
MBS4503560-04 10x 96 Tests

Human Lactase (LCT) ELISA Kit

Sign In for Pricing
View Details