Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fkrp Rabbit Polyclonal Antibody (Biotin)

Fkrp Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LGMD, MDC1C, LGMD1I, AI842067, AI847300, A830029B19Rik

UniProt

Q8CG64

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LDHRQDVEFPEHFLQPLVPLPFAGFMAQAPNNYRRFLELKFGPGVIENPE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_775606

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Toll Like Receptor Adaptor Molecule 1 (TICAM1) ELISA Kit
RDR-TICAM1-Hu-01 96 Tests

Human Toll Like Receptor Adaptor Molecule 1 (TICAM1) ELISA Kit

Sign In for Pricing
View Details
Human Toll Like Receptor Adaptor Molecule 1 (TICAM1) ELISA Kit
RDR-TICAM1-Hu-02 48 Tests

Human Toll Like Receptor Adaptor Molecule 1 (TICAM1) ELISA Kit

Sign In for Pricing
View Details
Peroxiredoxin 1 (PRDX1) (NM_181696) Human Over-expression Lysate
LC403646 20 µg

Peroxiredoxin 1 (PRDX1) (NM_181696) Human Over-expression Lysate

Sign In for Pricing
View Details
GNAS (C-term) Rabbit Polyclonal Antibody
AP51874PU-N 400 µL

GNAS (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NCE2 (UBE2F) Rabbit Polyclonal Antibody
TA366396 100 µL

NCE2 (UBE2F) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MSH2 Rabbit Polyclonal Antibody
TA372365 100 µL

MSH2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details