Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fkrp Rabbit Polyclonal Antibody (HRP)

Fkrp Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LGMD, MDC1C, LGMD1I, AI842067, AI847300, A830029B19Rik

UniProt

Q8CG64

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FPEHFLQPLVPLPFAGFMAQAPNNYRRFLELKFGPGVIENPEYPNPALLS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_775606

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PEX5 (NM_001131024) Human Over-expression Lysate
LY427362 100 µg

PEX5 (NM_001131024) Human Over-expression Lysate

Sign In for Pricing
View Details
FAM180A Human Gene Knockout Kit (CRISPR)
KN417145 1 Kit

FAM180A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Adipose Triglyceride Lipase (PNPLA2) (NM_020376) Human Over-expression Lysate
LY402777 100 µg

Adipose Triglyceride Lipase (PNPLA2) (NM_020376) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Skin
CS625107 5x 5 µm

Frozen Tissue Sections, Skin

Sign In for Pricing
View Details
TissueScan, Thyroid Cancer cDNA Array
HTRT101 2 Panels

TissueScan, Thyroid Cancer cDNA Array

Sign In for Pricing
View Details
LRGUK Antibody (Biotin)
KB-28956-01 50 μL

LRGUK Antibody (Biotin)

Sign In for Pricing
View Details