Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fkrp Rabbit Polyclonal Antibody (HRP)

Fkrp Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LGMD, MDC1C, LGMD1I, AI842067, AI847300, A830029B19Rik

UniProt

Q8CG64

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FPEHFLQPLVPLPFAGFMAQAPNNYRRFLELKFGPGVIENPEYPNPALLS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_775606

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR2E3 Mouse Monoclonal Antibody [Clone ID: OTI2F6]
CF806217 100 µg

NR2E3 Mouse Monoclonal Antibody [Clone ID: OTI2F6]

Sign In for Pricing
View Details
Mouse Dand5 activation kit by CRISPRa
GA204787 1 Kit

Mouse Dand5 activation kit by CRISPRa

Sign In for Pricing
View Details
PFTK1 (CDK14) (M1) Rabbit Polyclonal Antibody
AP52091PU-N 400 µL

PFTK1 (CDK14) (M1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Nme5 (BC049625) Mouse Tagged ORF Clone
MG200461 10 µg

Nme5 (BC049625) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
GMPR2 (NM_001002002) Human Recombinant Protein
TP323106L 1 mg

GMPR2 (NM_001002002) Human Recombinant Protein

Sign In for Pricing
View Details
MUC2 (Mucin 2) (MLP/2970R), CF640R conjugate, 0.1mg/mL
BNC402970-500 1x 500 µL

MUC2 (Mucin 2) (MLP/2970R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details