Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MLN Rabbit Polyclonal Antibody (HRP)

MLN Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC138519

UniProt

P12872

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MLN

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

3kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Sheep

Tested Applications

WB

NCBI Accession Number

NP_002409

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Pulmonary surfactant-associated protein A ELISA Kit
MBS2884215-01 48 Well

Rat Pulmonary surfactant-associated protein A ELISA Kit

Sign In for Pricing
View Details
Rat Pulmonary surfactant-associated protein A ELISA Kit
MBS2884215-02 96 Well

Rat Pulmonary surfactant-associated protein A ELISA Kit

Sign In for Pricing
View Details
Rat Pulmonary surfactant-associated protein A ELISA Kit
MBS2884215-03 5x 96 Well

Rat Pulmonary surfactant-associated protein A ELISA Kit

Sign In for Pricing
View Details
Rat Pulmonary surfactant-associated protein A ELISA Kit
MBS2884215-04 10x 96 Well

Rat Pulmonary surfactant-associated protein A ELISA Kit

Sign In for Pricing
View Details
Rat Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 6 (AGAP6) ELISA Kit
MBS7205769-01 48 Well

Rat Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 6 (AGAP6) ELISA Kit

Sign In for Pricing
View Details
Rat Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 6 (AGAP6) ELISA Kit
MBS7205769-02 96 Well

Rat Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 6 (AGAP6) ELISA Kit

Sign In for Pricing
View Details