Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPOCK3 Rabbit Polyclonal Antibody (FITC)

SPOCK3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TES-3, TICN3, HSAJ1454

UniProt

Q9BQ16

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SPOCK3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VDRYGNEVMGSRINGVADCAIDFEISGDFASGDFHEWTDDEDDEDDIMND

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001035249

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRMT2B 3'UTR Luciferase Stable Cell Line
TU026621 1.0 mL

TRMT2B 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
B230312A22Rik Recombinant Protein (Mouse)
RP118460 100 µg

B230312A22Rik Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Pig coagulation factor III, FIII ELISA Kit
CSB-E14999p-01 24 Well

Pig coagulation factor III, FIII ELISA Kit

Sign In for Pricing
View Details
Pig coagulation factor III, FIII ELISA Kit
CSB-E14999p-02 96 Well

Pig coagulation factor III, FIII ELISA Kit

Sign In for Pricing
View Details
Pig coagulation factor III, FIII ELISA Kit
CSB-E14999p-03 5x 96 Well

Pig coagulation factor III, FIII ELISA Kit

Sign In for Pricing
View Details
Pig coagulation factor III, FIII ELISA Kit
CSB-E14999p-04 10x 96 Well

Pig coagulation factor III, FIII ELISA Kit

Sign In for Pricing
View Details