Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLDND1 Rabbit Polyclonal Antibody (HRP)

CLDND1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Z38, C3orf4, GENX-3745

UniProt

Q9NY35

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CLDND1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001035271

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLF Blocking Peptide
MBS9623438-01 1 mg

KLF Blocking Peptide

Sign In for Pricing
View Details
KLF Blocking Peptide
MBS9623438-02 5x 1 mg

KLF Blocking Peptide

Sign In for Pricing
View Details
Recombinant Pegylated Mouse Leptin Triple Antagonist, Pegylated
7-01200 1 mg

Recombinant Pegylated Mouse Leptin Triple Antagonist, Pegylated

Sign In for Pricing
View Details
Rabbit Anti-Oryza sativa GUN4 pAb
PA12279-01 50 μL

Rabbit Anti-Oryza sativa GUN4 pAb

Sign In for Pricing
View Details
Rabbit Anti-Oryza sativa GUN4 pAb
PA12279-02 100 μL

Rabbit Anti-Oryza sativa GUN4 pAb

Sign In for Pricing
View Details
Krt36-set siRNA/shRNA/RNAi Lentivector (Mouse)
26023094 4x 500 ng

Krt36-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details