Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABHD12 Rabbit Polyclonal Antibody (HRP)

ABHD12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PHARC, ABHD12A, BEM46L2, hABHD12, C20orf22, dJ965G21.2

UniProt

Q8N2K0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ABHD12

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQFVPFHSDLGYRH

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001035937

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-High mobility group protein B4 HMGB4 Antibody Picoband®, PE Conjugate
PA1042-PE 100 µg/Vial

Anti-High mobility group protein B4 HMGB4 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
Olfr635 ORF Vector (Mouse) (pORF)
ORF052791 1.0 µg DNA

Olfr635 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Mouse Haptoglobin Beta Chain (HP) CLIA Kit
abx492074-01 96 Tests

Mouse Haptoglobin Beta Chain (HP) CLIA Kit

Sign In for Pricing
View Details
Mouse Haptoglobin Beta Chain (HP) CLIA Kit
abx492074-02 5x 96 Tests

Mouse Haptoglobin Beta Chain (HP) CLIA Kit

Sign In for Pricing
View Details
Mouse Haptoglobin Beta Chain (HP) CLIA Kit
abx492074-03 10x 96 Tests

Mouse Haptoglobin Beta Chain (HP) CLIA Kit

Sign In for Pricing
View Details
Human IL-17F ELISPOT kit
CT418-T5 5 Plates

Human IL-17F ELISPOT kit

Sign In for Pricing
View Details